PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_38.34
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 288aa    MW: 31894.8 Da    PI: 7.8441
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_38.34genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_125.82.3e-082332791763
                                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                  A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +e+
  evm.model.supercontig_38.34 233 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSMEN 279
                                  89***********************************9998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.7E-4222281IPR004827Basic-leucine zipper domain
CDDcd147031.14E-15224272No hitNo description
SuperFamilySSF579596.88E-6233275No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-8233276No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MANSKGSTNI RSLMYSGKHA LLPPKSPFYS LIGSKAVQKP REGNTHHQRT SSESLLIEEQ  60
PSWLDDLLNE PETPVRKGGH RRSSSDSFAY FDVSNTSITD YAAQDENKYR SMISVPSQGS  120
QEFDYHRDAR HTSFYPEASL LKQKNRPWDS SSSAGAHSSS LPSARESIAV QSSGSLCAPR  180
ELEAVSSSAS EKQDPAESGS HDPAKASSEK KDNTHNKASG SDTDTKRAKQ QFAQRSRVRK  240
LQYIAELERN VQALQAEGSE VSAELEFLNQ QNLILSMENK ALKQRLEX
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1355831e-60BT135583.1 Lotus japonicus clone JCVI-FLLj-21M13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007042281.11e-149Basic-leucine zipper transcription factor family protein isoform 1
RefseqXP_007042282.11e-149Basic-leucine zipper transcription factor family protein isoform 1
SwissprotQ8W3M73e-80Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A061E7681e-149A0A061E768_THECC; Basic-leucine zipper transcription factor family protein isoform 1
STRINGPOPTR_0004s22880.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Representative plantOGRP42521219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.26e-96bZIP family protein